PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn217911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 292aa    MW: 32594.2 Da    PI: 5.8716
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn217911genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.44.1e-3710106197
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 aC+aCk++rr+C+++C+lapyfp ++pk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+A++r r Pv+G++ vi ++q q++q+++el ++
  Achn217911  10 ACSACKYQRRRCSSECPLAPYFPPDKPKMFQNAHKLFGVSNILKILKQLNTVQKMEAMRSIIYQANIRDRFPVHGCCWVIAQVQYQIQQAEEELYVV 106
                 7*******************************************************************************************99766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5849110IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-3610105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTLKGGTSQA CSACKYQRRR CSSECPLAPY FPPDKPKMFQ NAHKLFGVSN ILKILKQLNT  60
VQKMEAMRSI IYQANIRDRF PVHGCCWVIA QVQYQIQQAE EELYVVLAQV AFFQQQQQQQ  120
ETDNNNNAND SASQLQALSL FHQEAPVNAA VAALPIASSY PNVAAAYSSG YPDHKDNLVN  180
SFWAQQHPYV NGNNNSSSSS NNNNNNNISM AMQSQMVSSP QLIIQQEQAQ EYYEMHPFFD  240
MIDDRQSYID SKEAYDSSSD SSLKDTTQSV KHVADNELKS AAACFSLTSV N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.11e-113PREDICTED: LOB domain-containing protein 27
TrEMBLA0A068UF741e-114A0A068UF74_COFCA; Uncharacterized protein
STRINGPOPTR_0012s07390.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-41LOB domain-containing protein 27